SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160488.PP_2166 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_2166
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000981
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_2166
Sequence length 160
Comment (Pseudomonas putida KT2440)
Sequence
MSTGRIQFAEQSGTFVLKFVGEVRLTLCSALDATIEKIFTALNFSAIVIDLTETESIDST
TLGLLAKLSILSRQKVGLLPTVVTTNPDISRLLQSMGFDQVFNIVDRPIPCTDCLTDLPS
QDQNEDVVRSKVLEAHKILMGLNDSNREAFHDLVNALERS
Download sequence
Identical sequences A0A0A7PZ52 A0A179SAM5 Q88KX3
gi|386013009|ref|YP_005931286.1| gi|26988890|ref|NP_744315.1| NP_744315.1.35174 WP_010953152.1.28295 WP_010953152.1.28475 WP_010953152.1.3142 WP_010953152.1.31851 WP_010953152.1.34900 WP_010953152.1.41 WP_010953152.1.42045 WP_010953152.1.48025 WP_010953152.1.58218 WP_010953152.1.62773 WP_010953152.1.675 WP_010953152.1.71439 WP_010953152.1.87606 160488.PP_2166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]