SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 160488.PP_4757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_4757
Domain Number 1 Region: 142-418
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.56e-85
Family D-glucarate dehydratase-like 0.000000000548
Further Details:      
 
Domain Number 2 Region: 10-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.02e-33
Family Enolase N-terminal domain-like 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_4757
Sequence length 448
Comment (Pseudomonas putida KT2440)
Sequence
MNMQTLHTSTPVVTDLRVVPVAGHDSMLLNLSGAHGPFFTRNVVVLRDSAGNTGLGEVPG
GEKIRQTLEDARSLVVGQPIGHYQRVLNAMRQTFANRDSAGRGLQTFDLRITVHAVTAIE
SALLDLLGQHLNVPMAALLGEGQQRDAVKMLGYLFYIGDRQQTDLAYRNEADSDDDWFRL
RHEKALTPEAVVRLAEAAKARYGFSDFKLKGGVLRGEEEMEAVTALAERFPEARITLDPN
GAWSLKEAIALCRDKHNVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDWRQ
MGHAIQLQSVDIPLADPHFWTLQGSVRVAQMCNDWGLTWGSHSNNHFDISLAMFTQVAAA
APGEITAIDTHWIWQDGQRLTREPLRIVDGHVRVPARPGLGVELDEDQLAKAHECYRNMG
LGARDDSVAMQFLIPGWSFDNKRPCLVR
Download sequence
Identical sequences Q88DR6
gi|26991438|ref|NP_746863.1| NP_746863.1.35174 WP_010955385.1.28295 WP_010955385.1.28475 WP_010955385.1.3142 WP_010955385.1.58218 WP_010955385.1.71439 WP_010955385.1.87606 160488.PP_4757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]