SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 160488.PP_4833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_4833
Domain Number 1 Region: 80-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000458
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_4833
Sequence length 143
Comment (Pseudomonas putida KT2440)
Sequence
MQWWIWLVFGIALILLELVLPTFFILWFGIGAVLVSLISLAAPSLQLDMQVLLWVLLSSA
TTVLWFKVFRRKQPDVRWTADSVIGEVGLLTAPVSEFQKGRVRFQKPILGNEEWTCVADS
QIAAGERVRLTAIEGNTARVIRA
Download sequence
Identical sequences Q88DJ2
gi|26991513|ref|NP_746938.1| GO.2636 160488.PP_4833 NP_746938.1.35174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]