SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160488.PP_5259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160488.PP_5259
Domain Number 1 Region: 94-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.41e-37
Family Phosphate binding protein-like 0.017
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-21
Family LysR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 160488.PP_5259
Sequence length 296
Comment (Pseudomonas putida KT2440)
Sequence
MSKRLVPSMTALQCFEAAARHLSFTRAAEELHLTQSAVSKQVAQLEDMLRHHLFLRIRRR
LQLTPAGSLYLAEVNKILTQVDMSSRYVLTYGEQTEILKVATQPSFGVRWLIPHLKGFGK
RHGNIHLDIRNEMEPFALLQGSADVVFFYGQGTWPGATCVELFREEVVPVCAPELLAGRK
LAGAEELAELVLLQSTSRPEAWHEWFLEQDLQSVSAYHGPRFDTFYMALSAAQAGCGVAL
VPRYLAAKELADGSLVVPWNHAMRSAGAHYLAYAEHAAEVPKVRALVEWIGEQLQV
Download sequence
Identical sequences A0A179S2K8 Q88CC2
160488.PP_5259 gi|26991935|ref|NP_747360.1| NP_747360.1.35174 WP_010955772.1.28295 WP_010955772.1.28475 WP_010955772.1.3142 WP_010955772.1.41 WP_010955772.1.58218 WP_010955772.1.71439 WP_010955772.1.87606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]