SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 160492.XF0184 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  160492.XF0184
Domain Number - Region: 102-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0109
Family NfeD domain-like 0.0084
Further Details:      
 
Domain Number - Region: 8-75
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0222
Family ABC transporter transmembrane region 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 160492.XF0184
Sequence length 144
Comment (Xylella fastidiosa)
Sequence
MMRWNAMGWAAAALLLLAAETLIPGAFMLWMGIAATAVFVGVLLLPDTSLLLQMFAFVVL
SFVSIYLYRTWFRRVDHDSDHPLLNRRADQLVGRVIILDHAIVDGNARIKIDDTFWDITG
PDLPIGTQIRIVALDGATLKVHPT
Download sequence
Identical sequences A0A1S0V9Q0 Q9PGW4
gi|15836789|ref|NP_297477.1| 160492.XF0184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]