SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 160492.XF1895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  160492.XF1895
Domain Number 1 Region: 145-259
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000097
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Weak hits

Sequence:  160492.XF1895
Domain Number - Region: 44-89
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0497
Family Multimerization domain of the phosphoprotein from sendai virus 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 160492.XF1895
Sequence length 271
Comment (Xylella fastidiosa)
Sequence
MRFWGSTFCVVAMALGTVAPSSAQMSSLADRVMALEQRASDPQVNIDLINQINDLRSQIR
QMQGSIEEMQHGYEQLKQQSKDQYLDLDSRLKPIESGSVKEPSRVLANPISQVSPSHFNQ
PIAMSEQSPNIHGDASALTISNEERIAYNVAFDALKNSKYADAAELFLSFLQLYPNGVYT
PNALYWLGESYYAMHDFVSAEAQFRSLLSRYPTHDKASGSLLKEALCQANQGKNDDAQHS
LEQVLSQYPGTDAARLAQERLQSIKLSQAMR
Download sequence
Identical sequences A0A1S0V7I8 Q9PC86
160492.XF1895 WP_010894361.1.14431 WP_010894361.1.3 WP_010894361.1.36406 WP_010894361.1.4338 WP_010894361.1.45907 WP_010894361.1.64904 WP_010894361.1.72049 WP_010894361.1.82282 WP_010894361.1.82778 WP_010894361.1.92333 WP_010894361.1.94175 gi|15838493|ref|NP_299181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]