SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00000521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00000521
Domain Number 1 Region: 295-362
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000121
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 2 Region: 166-203
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000763
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00000521
Sequence length 628
Comment (Aspergillus nidulans)
Sequence
MSSSVHFKFKSQKEPSRVTFDGTGISVFELKREIINQSRLGDGTDFELSIYNEDTGEEYD
DDTSVIPRSTSVIARRLPASRPGKGGAARYVSGKMPVNARSVPRNEQSTSNRTVSNPTQP
VSNGVQELHNAQTEEEKINALFNLQANQWREQQQEMANATPVPFGRGRGKPVNVPDHPPP
PGYLCYRCREKGHWIQACPTNNDPKFDGKYRVKRSTGIPRSLQTKVEKPESLLIDGSTED
LRNTGVMVNADGDFIITKPDQASWELYQEKVKATAAAAAEAAAAEHSKELQARGLECPID
KRMFLEPTQTPCCQKTYCNDCITNALIESDFVCPGCGTEGVLLDNLSANDEMLSKIKAYE
TEKADSKKEKEKQLTPTEVQPDNNTPVHISDTTERKGDSRSAPVDSKKRPAEDDPVTGTS
EEPGSGSSNKKQRSQDAQSSTETSEPRTENTSTTFQPLPFNPQMSFGMPGFMPGPGLPGM
PFPDAAFGGEGMGFMNPMGLPAGPGFPPNMDHNWNPLNMLNFNPLSNGMYNNRPNGPFLN
GFGAPNAYNGTGDQSMNMLAMPPISGPMAQNPGFGQGMGAGNFSNQQRTAFSTPFAREED
SPYFRQPVNPQRHQARNRRIRPSDYREL
Download sequence
Identical sequences A0A1U8QZG0 Q5AW99
162425.CADANIAP00000521 ANID_07431T0 XP_680700.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]