SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00000974 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00000974
Domain Number 1 Region: 316-354
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000241
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00000974
Sequence length 377
Comment (Aspergillus nidulans)
Sequence
MRRPFTMTMEEESVALLLQQLQELRTEMRTQKQQLQEENNSLRAELQAVRNSQLRNHPPV
TTTVTSATPTPYERSYPRPRHPDVEPFTGEDPKDYPPFQMNLRTKFAIDAACYPTEEEQV
YYAYSRLRGKASQRVLPWLLARQKSETPVLWAEFSAVLDKAFGDPDRQRKALVRVNTMKQ
GKRDFEEFLNEFDEELLNAGGINWDDNQKKALLDTAINVELLKAMVGIRQEDSYDNYCNQ
LREINHNLQRVARLTRKGSRAAVPTHVARTRPAGGSDRTGTPDQMDWEATHAQIAALQKE
VAALRTKGTRTPRKASQAPAEEKQKRLSEGKCLRCGDPDHFIQECPTKPTRRPRQVATVQ
EEQDQMDDYSESESENE
Download sequence
Identical sequences C8VDV5
162425.CADANIAP00000974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]