SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00000992 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00000992
Domain Number 1 Region: 260-298
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000153
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00000992
Domain Number - Region: 11-53
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0942
Family Moesin tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00000992
Sequence length 321
Comment (Aspergillus nidulans)
Sequence
MRRPFTMTMEEESVALLLQQLQELRTEMRTQKQQLQEENNSLRAELQAVRNSQLRNHPPV
TTTVTSATPTPYERSYPRPRHPDVEPFTGEDPKDYPPFQMNLHKAFGDPDRQRKALVRVN
TMKQGKRDFEEFLNEFDEELLNAGGINWDDNQKKALLDTAINVELLKAMVGIRQEDSYDN
YCNQLREINHNLQRVARLTRKGSRAAVPTHVARTRPAGGSDRTGTPDQMDWEATHAQIAA
LQKEVAALRTKGTRTPRKASQAPAEEKQKRLSEGKCLRCGDPDHFIQECPTKPTRRPRQV
ATVQEEQDQMDDYSESESENE
Download sequence
Identical sequences C8VDX3
162425.CADANIAP00000992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]