SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00001834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00001834
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000385
Family Centromere-binding 0.034
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00001834
Domain Number - Region: 528-553
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.017
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 
Domain Number - Region: 198-276
Classification Level Classification E-value
Superfamily PapD-like 0.0296
Family Pilus chaperone 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00001834
Sequence length 553
Comment (Aspergillus nidulans)
Sequence
MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITSIREAARRFNVPESTLRTRLRGTTNRAE
SRANGHKLTEIEEEVLKQWILSLDLRGAAPTKAHVREMANILLAKRGSTPIQTVGQKWVY
NYTQRHPELESRLSRQYDCQRAKQENPKVIQAWFNTVRATIEQYGILPDDIYNFDETGFA
MGLCAHQKVITKSESCGRRPVLQPGNREWVTAIESISASGWALPILIFKGKQYNQAWFTG
LPPDWRFEISTNGWTTNEISLRWLQKQFIPSTEHRTRGRYQLLVLDGHGSHLTPEFDQIC
TDHNIIPLCMPAHSSHLLQPLDIGCFAVLKRSYASLVDQKMRLGISHIDKLDFLAAYPQA
RISTFKLDTIRNSFRAAGLVPLNPEPVLSKLSIQACTPTPPGSRGSQASTFCPHTPANVD
ELLKQASLLRDFLKQRSKSPPSPSHNALNQLIKGCQIAMQKGILLEQENRALRAENAIQR
RKRARTHRWIAHDNGLSVQEATELEEAHNASFQAIPGPCGPPAEGAQTPKARALPTCSTC
HRIGHRRNACPNK
Download sequence
Identical sequences A0A1U8QGX8 Q5BF54
162425.CADANIAP00001834 XP_658430.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]