SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00003050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00003050
Domain Number 1 Region: 16-117
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000317
Family Paired domain 0.081
Further Details:      
 
Domain Number 2 Region: 702-736
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000119
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00003050
Sequence length 778
Comment (Aspergillus nidulans)
Sequence
MPTTPEPPEPPNQKSARLSRDDRLRILTLRDAGFTYHQIATQLRLTHRQVQYTCQSQQAT
PKKPRGQKPKLSEEDVDKILEFICSSERTRRLPYYKVIQELDLPVGTTALARALAKRGYT
RCKALERPPQSDSNNSNQHSNATCLTSGYHKGIYMTRKGGEEFESWLWTSPQKLWNVWET
NPWLFSSALCLLEKWTFRELQQRKTQYLKTATAPGASKTVDLGPEIPTGTTEATVFETAE
TYKTVERIQSAKGIKIDDPSGQLHAKLAAEDPDRRLQGEPVSGTLGIEESTSGMSGELEI
PAYQAVAPRKIVAFKIEKLDRTNVSSWKVQYKLFLRTQGCWSVVEHTYNWRGNAPWVKKL
LEDPAWEALDAMAKLYILQNIKVEDKASVLRLETSGDMWAFLMKKYERRTQVDVTNAIRK
VTRWQMDPKMSLEGAMQQLDQYNAELEDISSGKVKFDSMAILIIFLNGLPSKYDSMKFSL
PVHEDLTRGVVLSRLQQQDSMMSTAKENWIVSANLTKTNVTTWKSDVREFCQIQGVWEVV
EQTLRRQNKPEELQKLLDQPLWASQDATARYYIMKSIKEEDMTAVRDMKSSGAVWKYLMS
RYERTTQYDTVRLAQRITQWKKNPKVDIEASLQQLEQLNADLYEVSDQKIKLHELMILVI
FLNGLPEEYSTMRDCLFGNIPLERGFILSRLQQKELQLRNSTSEKTGKSANRAEQRKCFN
CGKRGHLIRDCGASKDLEQSNSWENPQGRSHRKGQSRARIHGNGRDKSRPAEEQLGSC
Download sequence
Identical sequences A0A1U8QFP7 Q5AT23
XP_681826.1.1458 ANID_08557T0 162425.CADANIAP00003050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]