SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00003095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00003095
Domain Number 1 Region: 105-148
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000105
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000886
Family Retrovirus zinc finger-like domains 0.0009
Further Details:      
 
Domain Number 3 Region: 69-128
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000121
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 4 Region: 3-25
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000767
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 5 Region: 150-170
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000293
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00003095
Sequence length 171
Comment (Aspergillus nidulans)
Sequence
MSFGGRVCFNCGEATHQARDCPKKGTPTCYNCGGQGHVSRECTVAPKEKSCYRCGAVGHI
SRECPQAGENERPAGGQECYKCGRVGHIARNCSQGGSYGGGFGGGYGGRQQTCYSCGGFG
HMARDCTQGQKCYNCGETGHVSRDCPTEAKGERVCYQCKQPGHIQSACPNN
Download sequence
Identical sequences C8VEX3
162425.CADANIAP00003095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]