SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00003619 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00003619
Domain Number 1 Region: 285-323
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000172
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00003619
Sequence length 346
Comment (Aspergillus nidulans)
Sequence
MRRPFTMTMEEESVALLLQQLQELRTEMRTQKQQLQEENNSLRAELQAVRNSQLRNHPPV
TTTVTSATPTPYERSYPRPRHPDVEPFTGEDPKDYPPFQMNLPSLRGKASQRVLPWLLAR
QKSETPVLWAEFSAVLDKAFGDPDRQRKALVRVNTMKQGKRDFEEFLNEFDEELLNAGGI
NWDDNQKKALLDTAINVEQEDSYDNYCNQLREINHNLQRVARLTRKGSRAAVPTHVARTR
PAGGSDRTGTPDQMDWEATHAQIAALQKEVAALRTKGTRTPRKASQAPAEEKQKRLSEGK
CLRCGDPDHFIQECPTKPTRRPRQVATVQEEQDQMDDYSESESENE
Download sequence
Identical sequences C8VGF0
162425.CADANIAP00003619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]