SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00004539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00004539
Domain Number 1 Region: 43-79
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000419
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 2 Region: 218-243
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000192
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00004539
Sequence length 272
Comment (Aspergillus nidulans)
Sequence
MPWHAGDGWGGGSDENREDEDNAEVLANGFLVTIMSGFLLSLSNHTKAECHKPRVFKGSC
RICNQEGHPAAECPDRPPDVCRTVNKRTSNCTENRKFGLNRIPDMLPERAWELLRKASYD
RDLEGFREGLKIYSKAVPNATFADIEEKMRAESFNIYLIAMERQTSDCISLISLQGKLNC
TYIVGLFYSPRPQRANLRECWPPSVEENIERLRDASLPYERQIPKCSNCGEMGHSSRSCK
EERVVIERVEVNVLTAANPDTALMIANNLVWH
Download sequence
Identical sequences A0A1U8QJU7 Q5B5P7
162425.CADANIAP00004539 XP_661737.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]