SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00004791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  162425.CADANIAP00004791
Domain Number - Region: 1025-1055
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00004791
Sequence length 1092
Comment (Aspergillus nidulans)
Sequence
MPHATATSPGPEVEDADFDNVMRQMNGPMTDGGMSFDFLSRELEPGEKADDAVDYEDFDD
DELPEEEEITQHNARAVAENGLEAPETSDDALFGGGGDDLFEAPGKDEQAAPDELDDLFG
EAPSSPRPDLADETRDLFFEEEERPTAVQRPQAIQMDEDQELLQDDEPLSPVADDMDPAS
LRAWKLQQALFAMSNVGPDNPPAPPENVEELLQSLFPMFERNTLPRFLELIPHKKAYFVG
KTPLKPPKPVLPGKVNIELAQDQEKVFRSGGQTFKRSLEAEHHGIVPVAETSQEEEEEEA
RDEFDLDYESDEPLPGGITADDLRVVCADWDVRDDIPTMDIDEPAIVESAEDDWLFETTR
PAKKRKLGRDPMEIVSLSHIDLPLLDDPEQASSKVAQKVTLDLNDPYMLLDERGPDTAAS
KPRASGVRSRDEMDANVTRRLTARYNISNDQAYDMLKQNHQNKVRSTLGNVTLEHSMPAL
RLQWPYYKTELAKAEARSFHRPALSFRPGQSCWFKNPAYIKRKHQKGKDIRQLYDSTKSL
SMADNSHVLLVEYSEESPLTLSNFGMANRIINYYRKKNAEDPTRPKAEIGETAVLLPQDK
SPFSIFGHVDPGEVTPAISNAMYRAPLFSHQPKSTDFLVIRNSTGSGGSDYYIRNIDNIF
VAGQQFPSVDIPGPHSRKVTTVAKNRMKMLVYRLLKKSPDLRLSISDVTAHIPGTSDMQN
RQKVKDFLQHDKDTKYWVPLEPVPEQDVIRSWVQPEDVCLLEAMQVGQQHLHDTGYGNDA
ETGGDDDNDEESESFEQQMAPWKASRNFLLASQGKAMLKLHGEGDPTGRGEGFSFIKTSM
KGGFKAIGESVEDKLDAQRLKELGGHSYNVARQQKSYETSIRRIWDAQKASLSSTIEHSD
DEVNMSEEEEDDFNKPTPRSEAPTPAPARRDDETTSQFSKMSRMSMSAHKGKVLRIVRQV
QDKDGVRQKETLVSDPRVIRHYLQHRHRVESLTTNLEQELSRLNRNKERRFAREKQKGVL
RNSADSPADGAPGSSKAGGTQRKCANCGQVGHIKTNKKCVYNRSRSAGAADGYPDSFDIT
QSFFVNPSTTFP
Download sequence
Identical sequences A0A1U8QTC6 Q5B6C3
162425.CADANIAP00004791 XP_661511.1.1458 ANID_03907T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]