SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00008093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00008093
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.55e-27
Family Cap-Gly domain 0.001
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00008093
Domain Number - Region: 182-233
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 648-665
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.034
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 263-356
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0392
Family Apolipophorin-III 0.0027
Further Details:      
 
Domain Number - Region: 533-570
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0733
Family Retrovirus zinc finger-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00008093
Sequence length 668
Comment (Aspergillus nidulans)
Sequence
MAPLDEIQVGDVVNVPGGMHGTVRFVGVVAGKPGRFAGIELAPEHAKRGKNSGDVDGKKY
FATAMPGSGIFVPLNNNKYVTRRTVSNPPTTPSRPVNFSKSVGPGVSVPRPPRMRRPSLP
RSESPRVTAPPKLSLSGLRTPSAASKTPTNGFSRSPVKAPSRASDRPPSRFSVEDGPTSA
RTSDYGRNSMGAEISDLKEQVKALEKQLLDRDQQLEEQANTLSDFQRTLEELEGSDALSI
RAQLREKNERIAQLTMEFDMHRADFRSTLDTLEVAASETERVYEQRIDELMQQNKELQDR
GEDVEAVARQLKQLEELVSELEEGLEDARRGEAEARAEVEFLRGEVERTKLELKKERESS
GLSRESRMSPDGHFSRELEQKDDEIRGLKAIIHSLSRGEPDLHALQQNGFGARPDHNADH
VADLEQRVQEYERANEHKTYRIEELERELQQLQANENGRTRSSTVTQSNAQHKPTGSAGK
ISNGHTINHAHRLSDRTVVPGDWQDEAPQDGLYPAYPSHGRGTSDTSARLETMHESDAQE
SDTRSEDGGSLWCEICETGGHDILSCTNMFGADAKNNKPAPAPEEQPSHEDSSADEKPSA
HSPSSSRSQNAPSQKTGRDVVLEGLRGVGLTSSMAPVAGKASGIIDETKWCALCERDGHE
SIDCPFDD
Download sequence
Identical sequences A0A1U8QGR0 Q5BDA5
XP_659079.1.1458 162425.CADANIAP00008093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]