SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00008604 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00008604
Domain Number 1 Region: 396-440
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000803
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00008604
Domain Number - Region: 359-396
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00454
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00008604
Sequence length 690
Comment (Aspergillus nidulans)
Sequence
MPDIPSDEEDSRNASLAAQRNRGSASASASNPSSRHASREPPSKRRRRGRGKQDVDVQDF
VPKGATFSATSLEIDPESESTSASESESSSGSESESESESESESESGSDSEKEIEPEIES
RGGGLSAPAPNWNKTGKSVIRTSLHGRQAANANLNGNGKNDAESESAAAKKFEAVNGMYW
RSRSSSASPGWKERKTVEEGKSETAVTDDNDVQIEDGEVNGVQEVSADSQSDDSGSLDSE
ADDSIMLNIGSRGQNRSQHDVIQISDDDSDSEGDGYDPESLSVSQTPATVNILDGSNGDG
VDGESIADSESKERALLRFAQKYPTSPSILADLTREDMELQARIMFYNRDINDINLQLPI
TCMECLQEGHLAEVCPTRECVHCGAWNKHQSSLCPKFRRCQRCRGRGHDAKDCPSALKSS
ASEIPCDLCGSADHLEYDCDYLWKLPRQDTTSLPVLVSISCAHCTSNRHLIGDCPSLSRP
FLSSSFTVRGIDPNLITNINSVVNPRRGGAGALSGRPGRQRGNGLKIRGRADQHAHSPSS
DSDDMMSMSLTRGGQGRRAGAGGNRSGNRGSINIRIGGDRSNGGPPPSSARDYRDRDDPY
FRGGFNSRQRSMSPGRDRGRPGRSRGRGGQQPPRSPPRGQGRPPGLSNQSRGGRGNGKGG
GGRGGRGGGGGDAYRPMPSAAKKAWDRYRL
Download sequence
Identical sequences A0A1U8QVM4 Q5BBY6
ANID_01944T0 XP_659548.1.1458 162425.CADANIAP00008604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]