SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00009521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00009521
Domain Number 1 Region: 141-190
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000181
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 2 Region: 45-93
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000764
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Domain Number 3 Region: 5-45
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000014
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00009521
Domain Number - Region: 110-138
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000602
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00009521
Sequence length 233
Comment (Aspergillus nidulans)
Sequence
MMLSRRACYKCGNIGHYAEVCSSSERLCYNCKQPGHESSSCPRPRTTETKQCYNCQGLGH
VQADCPTLRLNGANGRCYNCSQPGHLARNCPAPASGAPRGTGAPRGGFGGGFRGGYGGYP
RAATCYKCGGPNHFARDCQAQAMKCYACGKLGHISRDCTAPNGGPLSSAGKVCYKCSQAG
HISRDCPNNEATTESAIPAAATAPVAAPVAAAAAAVETDAGPVAAAAPTTAVA
Download sequence
Identical sequences C8VH53
162425.CADANIAP00009521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]