SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00009545 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  162425.CADANIAP00009545
Domain Number - Region: 143-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00285
Family Galectin (animal S-lectin) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00009545
Sequence length 300
Comment (Aspergillus nidulans)
Sequence
MADKIYPPPPGPPPGYTEGPPPPYHNWQEAVPDTTEYPPPPISGNYYSNAGNASADDAER
AHNFCNSTPLYRPVQPSTVVYNSVQNYNISPVLPAEFRGNISGHHGRWKGSTRNRNSDCV
LLTNLPIYFALVDSPFVTERKKTIYYEVKLLGLRTGPTPNDASGLSIGFAAQPYPTWRSP
GWERGSLAVFSDDGCRFTNDSFGGKDFTDPFRVGETVGLGMTFELETPVSQPTQKLSVNI
FFTRNGQHAGGWDLHEEVDEEAGSVEGLGGEVDLYGAIGLFGGVDFEICYHPGGWLYRPQ
Download sequence
Identical sequences A0A1U8QXL2 Q5ARL0
XP_682339.1.1458 162425.CADANIAP00009545 ANID_09070T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]