SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00010225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00010225
Domain Number 1 Region: 304-334
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000262
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00010225
Sequence length 416
Comment (Aspergillus nidulans)
Sequence
MSLPWAFDRSTEKIDQTETAPGASETVDIEPTETAETDKTVERTVPERIQSANSIEIDDP
SKQLQGEPVYRILSIEELTSGMSRQSERLPPLDKGDRIKPVGVKYDVLDASNIRLWKKKI
EGLLRLQKCWKVVENTRKMRIDGKTELLHQAMQDEDYIDHNLLAVTYLTAYISEEDANAV
KNLEISGDIWIYLMEKYEAVNPRRKVNLLMRLFTWKMDPKMKIREAIQDLEKLHEEVKDV
WEKEYLDQDALMVLFLCGLPPEYEAYADGLRSIGDTKRAVILSRLEEKEISTRAERRAEV
ISKSANRAEQRRCFNCGKKGHFARDCTAPEKNREQSNSREDSQGWSHRRDHGKARAYGNG
RDKSRRGHTGRQRGGARTANEETDTASFCPFPFEHLQQLIYLQMERFYENPHDFDV
Download sequence
Identical sequences A0A1U8QKV1 Q5B9B5
162425.CADANIAP00010225 ANID_02865T0 XP_660469.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]