SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 162425.CADANIAP00010381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  162425.CADANIAP00010381
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000034
Family Centromere-binding 0.034
Further Details:      
 
Weak hits

Sequence:  162425.CADANIAP00010381
Domain Number - Region: 478-503
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0152
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 162425.CADANIAP00010381
Sequence length 503
Comment (Aspergillus nidulans)
Sequence
MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITSIREAARRFNVPESTLRTRLRGTTNRAE
SRANGHKLTEIEEEVLKQWILSLDLRGAAPTKAHVREMANILLAKRGSTPIQTVGQKWVY
NYTQRHPELESRLSRQYDCQRAKQENPKVIQAWFNTVRATIEQYGILPDDIYNFDETGFA
MGLCAHQKVITKSESCGRRPVLQPGNRDNGLRWLQKQFIPSTEHRTRGRYQLLVLDGHGS
HLTPEFDQICTDHNIIPLCMPAHSSHLLQPLDIGCFAVLKRSYASLVDQKMRLGISHIDK
LDFLAAYPQARISTFKLDTIRNSFRAAGLVPLNPEPVLSKLSIQARTPTPPGSRGSQAST
FCPHTPANVDELLKQASLLRDFLKQRSKSPPSPSHNALNQLIKGCQIAMQKGILLEQENR
ALRAENAIQRRKRARTHRWIAHDNGLSVQEATELEEAHNASFQAIPGPCGPPAEGAQTPK
ARALPTCSTCHRIGHRRNACPNK
Download sequence
Identical sequences A0A1U8QT19 Q5B9P8
XP_660336.1.1458 162425.CADANIAP00010381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]