SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 163164.WD0494 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  163164.WD0494
Domain Number 1 Region: 141-417
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-121
Family Enolase 0.0000000491
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.89e-55
Family Enolase N-terminal domain-like 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 163164.WD0494
Sequence length 424
Comment (Wolbachia endosymbiont of Drosophila melanogaster)
Sequence
MNKVINNVFAREILDSRGYPTIEVEIELCDGAIGRASVPSGASTGKLEVLELRDQDEKRY
CGKGVLKAVQAVNGIIADEIIGMNAADQNAIDKALIELDGTKNKSKLGANATLGVSLAVA
KAAANSFKMPLYRYLGGKQTSVMPVPLINIINGGVHADNKLDFQEFMILPVGAETFSEAI
RISAEVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDLIIYVIESAGYSAQSDFAL
GLDVASSTFYEDGIYKFEHRDLTSEELTEYYCNLVERYPIISIEDAMSEDDYEGWKLLTA
KLGSKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQIGTLTETFAAIEMAKSNGYKA
VVSHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAKYNELIRIESALGKDAKYYRGL
AWVL
Download sequence
Identical sequences Q73HQ2
163164.WD0494 WP_010962634.1.65598 WP_010962634.1.78080 gi|42520362|ref|NP_966277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]