SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI48386 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI48386
Domain Number 1 Region: 46-100
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000972
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 2 Region: 1-43
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000014
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Weak hits

Sequence:  164328.JGI48386
Domain Number - Region: 105-124
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0356
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI48386
Sequence length 124
Comment (Phytophthora ramorum)
Sequence
CWLCGETSHRKQDCPNRAAGDVNKTCFQCRRRGHTSHNCPQNGGGGFGQQQQAAVCFNCG
ANDHALRDCQRPMENGGATYATCFVCGQQGHLSGKCPQNTMGVYPKGGCCKLCKSVEHLA
RDCP
Download sequence
Identical sequences H3G6Y0
164328.JGI48386 jgi|Phyra1_1|48386|gwEuk.4.25.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]