SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI72151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI72151
Domain Number 1 Region: 174-464
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-122
Family Enolase 0.00000000766
Further Details:      
 
Domain Number 2 Region: 37-173
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.02e-53
Family Enolase N-terminal domain-like 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI72151
Sequence length 468
Comment (Phytophthora ramorum)
Sequence
MSKPSLLQRTCWCLVCAFKSDLTFLANGSGRNHHLFLSIHAREIIDSRGNPTVEVDLTLS
GSAEIFRASVPSGASTGIHEAVELRDGGKRYAGKGVQQAVQNVKSVLAPKLIGADPTKQR
DIDNLMREIDGTENKGKLGANAILGVSLAVAKAGAAAKGVPLYQHFADLIGNKNLVLPVP
SFNVINGGSHAGNKLAFQEFMLLPTGAESFSEAMVMGCEVYHQLKSVIKKKYGQDATNVG
DEGGFAPNIQSNREGVELLMTAIGRAGYDGKIGIGMDVASSEFLTKEGKYDLDFKTEGST
DLLTGEELGQLYKDLAKEFPIISIEDPFDQDDWTHYSSFTAGIGEKVQIVGDDLLCTNPK
RIATALDKKACNALLLKVNQIGSVTESVDAVALAQKNGWGVMTSHRSGETEDSYIADLAV
GLATGQIKTGAPCRSERLAKYNQLLRIEEALGSDAKYAGVHFRNPSKM
Download sequence
Identical sequences H3GAG9
164328.JGI72151 jgi|Phyra1_1|72151|fgenesh1_pm.C_scaffold_94000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]