SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI72520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI72520
Domain Number 1 Region: 25-86,114-201
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000845
Family Reverse transcriptase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI72520
Sequence length 215
Comment (Phytophthora ramorum)
Sequence
MCSIGFQVSAFDPCLYIKVVDGQCVLVLVYVDDVLITGSSPELISRTKTDLKTRFEMTDS
GKCAFVLGIELVDGPDGSVTMCQRRYVDDILKRFAMDECKAVVSPVDMSTRLVPSDAATK
VNAPFREAVGALMHLMTATRPDIAYAVGYVSRFMENPQEEHWVAVKRIFRYLQGTKTHGI
CFKPGDKIDFRGYSDADWAGDLADRKSTSGTRSCS
Download sequence
Identical sequences H3GB86
jgi|Phyra1_1|72520|fgenesh1_pm.C_scaffold_1866000001 164328.JGI72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]