SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI72653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI72653
Domain Number 1 Region: 503-592
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000398
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 2 Region: 331-362
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000767
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI72653
Sequence length 592
Comment (Phytophthora ramorum)
Sequence
MQAEPGRVRTGSDDGVESIAVARARGDSNPGNLAAATTEGDEASELLTLVRGIVGRLDKL
EQSQSKLEQHLEPPKKEPKTIMDTSLVASALGRSSPQYFGLRHAAHEPSNGMSDLQRLYA
SEHAAQAEAQPPAIPTQNQGGAFRNPDARQKKLVIRPFDGVELYVGLGSGFLDWGRRFKR
QEDVKVDHLGHYLSGTTERYYNKQVDTWWNQLPTLQYVMERMLDAFKTNITPAQAMKMFT
ASKDTKRPWPEHYMYLVAVSEARRTSVEYLALNNIVPYASTELRTVLMAKVDQSRTDYLR
HAEELAHFERSWETESTKQKSLGRETVNAVRECNNQRLETRSCYECGRVGHLRAACPDGK
QRAHLALAVVNLVNEESFLEDVEECSDGCVQPNGESLNITKRGKVMLRITACGEEQMVEL
TNVYFARDVEHNLISYELLDNRGFELAHRAGRRVVVAKDGGRVAFDVEMRRNVLVVPAAM
RRRHDLPSDVIMAVLIQELTQSVEVSVDSNYCHVFLARTQDAAVKLFEHFLVYFEKEFDC
KIHVLRTDSGGEYENVDLFCKRTGVTRQRSEARNYSSDGKAKRMHRTIMNMA
Download sequence
Identical sequences H3GBI0
jgi|Phyra1_1|72653|fgenesh1_pg.C_scaffold_1000095 164328.JGI72653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]