SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI72896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI72896
Domain Number 1 Region: 387-554
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-27
Family Retroviral integrase, catalytic domain 0.0089
Further Details:      
 
Domain Number 2 Region: 767-953
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000191
Family Reverse transcriptase 0.042
Further Details:      
 
Weak hits

Sequence:  164328.JGI72896
Domain Number - Region: 185-212
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000136
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI72896
Sequence length 1214
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKSVWHVVNRETTPSFTDPRPKDEYVKSSNIALGLMLLHMDADYHHVVDDCE
EAWVAWMRLKTLYGGSQKAGRIYLKRQLFSMEMSEGGNVLHHCNEVLNISAKLSSIGAKM
EDEDVAICLLRSLPKSYENAVLNLEMSSAELRSQDVVKVLTNEHIKRQGEKTATVKTEDA
AKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRSPRRGGNGNGRGRGANNAQWRNDDA
SYDYGYGYDRVAFAVSLECGISTGKDMIGMWAVDSGATHHICNDKAKFAHLIERNEGELS
VADGNKAAWGPSWNEWFCPTATSATSRSRTRLGRRSTCTRVWVEVLRKMVDNDMIKDAKA
PSKSSGPSVCRGCQQGKMVQKPFPSNRNKRRHDTFELLHFDICDHMEEESLGGSKYLLLI
VDEASGCMKRFCLRTKSESEDCIKTYVTKVQTQFGKKVKFVRHDGAREFATNSLKASYEV
EGIEQQTTVPYAHQANGTAERAIRTIVTIGRSMLHHAKLDKCFWAEAAMTAIYVKNRLPS
PKVEHKTPFEIVYKSKPSTYILTPKEKRRKWDPKARAGLFLGYEEVSKAYRLYDIEAGQV
VVSRDVNFDELAFGLSTHTSDEDVDDAALDLDALDLDDNDGPHQTSFKQAGKRKYRPSGD
DDTARRSRPVRHRAGLEEASAPDVSSSRRAEPDEEEKSGDQDEDDDSTPPVFWRASANAV
EEAADLSEPTTFQEAVNGPDQVHWRKAIRAELKSMRLRDRPATEWVFKIKRKADGSIEKY
KARLVAKGFKQKYGIDYTETFSPVVKYVTLRMIIAIAKYFGWPLDQLDVVTAFLYGVMKE
VVFCVVPEGVELDGGFDCLELVKAIYGLKQASRVWNETFDQFMCSIDFQVSAFDPCLYIK
VVDGQCALVLMYVDDVLITGSSLELIARTKTDLKTRFEMTDSGKSAFVLGIELVMVHVAL
SPATELVDGPDGSVTMCQRRYVDDILKRFAMDECKAVVSPVDMSTRLVPSDAATKVNAPF
REAVVELNRDVWLLLKRGYLTLGVGDPSATSCSVRILVRPDYTGKEKSNLTLNEVEYQNC
NELQPAELVAMVRQWGGTDVVVVSHTKYQGIEQMWPPIWCMQVAAHSNPVTYAFRLFFIS
PAEANTVYGNYLKATTPRVCRYGNPVDTAELKMVANVDWDGRHSRLYRTGTDVDNNMCKL
MILGLRNEVTHDQL
Download sequence
Identical sequences H3GC12
jgi|Phyra1_1|72896|fgenesh1_pg.C_scaffold_1000338 164328.JGI72896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]