SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI73098
Domain Number 1 Region: 174-355
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.12e-39
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0025
Further Details:      
 
Domain Number 2 Region: 8-171
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.94e-28
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.045
Further Details:      
 
Domain Number 3 Region: 391-418
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000015
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73098
Sequence length 575
Comment (Phytophthora ramorum)
Sequence
MGAANSVRKLTIDSMALLEQLEPSAAELGAKRAVRRRVQQLLRQQWPTCRVLPFGSSESG
LGFGGCDVDLGIYFENAQGQFSPQERVELLATACERLSGAFQVEQFVRNARVPVIKLWDP
KRQVWRLVLVVCERFEARYRLLRSCVQVACDVCVGGVNALLNTALLKYYGQVDPRVRPLV
FAVKYWAKQRGINDSVNGTLSSYGYTLLLIFYLQSHYAEMQLPAVHTVFQNLQSHTSIGV
LLDRLQSLPTMELSSTFGTMSINSVGALLAGFFEFYAHRFNMEDEVVSIRMGRALSKTTK
WSHPMSWRLSIEDPFELAHDIGRVIFHRKGQQLLRSEFQRASDMLSGDHRLEDICGLDES
AWNVMATCYICYGRDHAARECGQLVHQRLTPGGSNSMSHFSDCWYCGEYGHYKAECPMLF
FRDIPRPIEVAKAGNISVAEMTSRSDFAPPLVGFTPASPPIAIPVRPAPKTMSPRVCKER
PWERGLSPSSSPMLRLSRKKKRARHGSTSSTSSSSSWNSPSNGLSQSEKRQQQQRYQQQR
HEQRRRNFVQLEPTRKCGGNARSGKTHVGKVLCPS
Download sequence
Identical sequences H3GCD6
164328.JGI73098 jgi|Phyra1_1|73098|fgenesh1_pg.C_scaffold_2000163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]