SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI73441
Domain Number - Region: 360-390
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00262
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73441
Sequence length 449
Comment (Phytophthora ramorum)
Sequence
MSDKEDSSFDELAARAAAKELSSAGSPSPRSRRRPRRSPELQLQLPNPFERRQEDESMPT
ASPERNAGGLSHGKEEQERSAPQRVAAAPALPQPPRFADRIMQDRRVFMREYETYMIAIN
ALQTQWNGAFAMPVGACIESRTKRMIARYEFNLPPNMISEQQWIDYFKQALSPSHIDYAT
VDKAMKKLRMETRWPEPESRMMNLQADMEAILDEFNLTDVAFAHEQRRLVKYLADALAPP
SFKAVIATKLTLRENKNFKNEVVPFCSWVTKLMKEFMTWEHAAQAAAGHTSSSQQQGGRR
GNNGGRGGEGARGANGGRGVSTGVSNSGRNNGAGSPPTRSGPGGGSAQGTASASVARAST
GADTRTERGTCLKCQATGQQVRECPRCEPGEAAQLLRAMREQRNASRPASMRKFDVTLPG
AELDDDQGTVAAAVDGVPSFSTLALTPHW
Download sequence
Identical sequences H3GD33
jgi|Phyra1_1|73441|fgenesh1_pg.C_scaffold_3000198 164328.JGI73441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]