SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI73484
Domain Number 1 Region: 191-218
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000795
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73484
Sequence length 414
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSE
GGNVLHHCNEVLNISTKLSSIGAKMEDEDVAICLLRSLPKSYENVLTNEHIKRQGEKTAT
VKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRGPRRGGNGNGRGRGANNAQ
SRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICNDKAKFADLIER
NEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSVPQINKSG
LFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQTPQRSANAATSGKTVDLHA
Download sequence
Identical sequences H3GD66
164328.JGI73484 jgi|Phyra1_1|73484|fgenesh1_pg.C_scaffold_3000241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]