SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI73577
Domain Number 1 Region: 328-365
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000523
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Weak hits

Sequence:  164328.JGI73577
Domain Number - Region: 472-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00295
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 639-665
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00353
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number - Region: 671-692
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0196
Family CCCH zinc finger 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73577
Sequence length 951
Comment (Phytophthora ramorum)
Sequence
MERFSSGGGSFRGGRGRGGFGRGRGGRGGRGRGRGRGGGRGGRGNFQQRRHDDAGYTEGY
APPQAPYPQQFGDFGQGYPPPQQGYAPPPPPQQGYAPPPQQFPPQQEQFQSQYQQYPPPP
QDQYQPPQYQQQGYADDSRGGYNGNPPPVADRYQPMDNFQNQPPPSAYQQYQQLPPQQYQ
PPPPQQQFQQFQDESPRYAANPPLPPQPPVDYADAARARQQAYAPIQSEDNTPEDPLPPY
QQSSQPPPPSYQQQPPPPLPPTPQSQRGDWNYVPPPQEQQWEQQLQQPQFGGPPPAYSPQ
GTNTGPPMDQQRHFQRDQNPRFQDRRQDRHDRQQHKPHRPPPPTYVCHNCNQPGHWKQHC
PLFANENENRAGPRQDDQFPQRYGPGPGPDRQWGSAPPAPGIKPQDPRRNGGSYHIVSPE
DVEDSGLAMKNEPRGQPPLPGGPAPPLPPDSQPPLPYGNDGYAQQQSQPQPGEQVWKCDT
CVKSFVIVSQYEAHIGTHVTCSDCDFSASKRVVTAHYQTAHGQYAGQGLKEIDVEGQKFM
VLVGNSVEDITKWREERRKRWLAMSSQPKPPAATPAPVAGKRKLSVSSEEDLEEGEIEED
EEAKAQIALKTAARKLATSDAGASETSGTGTHEPPAKKQRKTMLCKWFSRGHCRFDEGHC
KYSHDRSAFGCRAMMYKGSCSKGMYCPFSHDTAVLSGQRERSQKASKERATEQQWHGEQK
SLLRKLLAKDVRVEQLKMLQIVHFLVANDFLRSPDGEKADESTSESAMKIEVLKSAEPST
AATAEASEPIESVSEDIVMEEASDEMEQVSTGEAQGAVPPQAMEADKVVAGNGNVVPVVE
ATACGQESQGVSESPITEETEVVAPSRDDESEVVVEASQGETMKDASSSAQDPQCHAEGA
ITEEVVVAVPSKDTELAQSVAPASGEEPAKDVPSGQASTLEASAGETNGES
Download sequence
Identical sequences H3GDE7
164328.JGI73577 jgi|Phyra1_1|73577|fgenesh1_pg.C_scaffold_4000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]