SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI73942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI73942
Domain Number 1 Region: 482-711
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-61
Family Reverse transcriptase 0.00036
Further Details:      
 
Domain Number 2 Region: 1847-2004
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.26e-40
Family Reverse transcriptase 0.0026
Further Details:      
 
Domain Number 3 Region: 1181-1345
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.17e-30
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 4 Region: 1565-1730
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000711
Family Reverse transcriptase 0.069
Further Details:      
 
Weak hits

Sequence:  164328.JGI73942
Domain Number - Region: 929-956
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000138
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 172-220
Classification Level Classification E-value
Superfamily Acid proteases 0.1
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI73942
Sequence length 2226
Comment (Phytophthora ramorum)
Sequence
MAMRDYVQRTRHLASCIVTKPIDMASQVHVFVFGMCEGMTRYSLTRAEPATLEEAFALAL
REDYLVTSSYAKMMPAQTRVSVPEPIEIDTIEASQNRRWSSSGRGRGGQNDLSLNYFRRG
KPGHRAAVCRAPAPILAHMKHVTPDERIPAAQPKNGRGHGDSRLIIVAGVRRPLRALLDS
GATNNFLRASCLSILPAGVPVRDVPGDVVVKLADGKPFRVARREVSLPVEHPSGYGRARR
AVEHPRLPRTRNKTAERTALPTTSTTVEQGLPHVYETVEQGLPYDDEAVELGLPHANEAV
EQRLLHAIKTVEQGLPYANEAVEQGLLHAIKTVEQGLPYDDTAVEQELLPRMSGAVEHGL
SRLEEGEASSGDSETSSNMWEVFPTTLEMIKVASPPRDAKSITDLPGLSWKSFLRDLKDG
DIEQVCLITDANPVSDEMNAIAHDDTSSRPKSAEPKSVREERFAAQSWESLKASGNPVYE
TAREFADVFPDKIPAELPADRGVRHEIDLVPRSKYCVTRQWPLSRDQVKAIDDFFEGRRQ
AGHVRESISPHSSPTFCVKKLNDATIPAQTPIPRKDMVLDSMSGSVIYSAIDLTDGFYQI
IMRESDVPLTAVNTPSGMLWEWLVMPQGLKNAPATFNRMVSHVLRPLRDFAPSYFDDIFV
HSHTEEGLSAVDVHLRHLRQVFQVMRENKLYANLKKCVFCAPEIPVLGCYVLRVMSPSTM
SSAHDASTKVSIDKFNGDNYAMWNRYMRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVKS
SNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSEG
GNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQDV
VKVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCSTKQKDENRG
PRRGGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSG
ATHHICNDKAKFAHLIERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALY
VPSMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASKQVVVAVNLVDGLYWPQTPQRSAN
AATSGKTVDLHARMGHAPVEVLRKMQGKMVQKPFPSNRDKRRYDTFELLHFDICGPMEEE
SLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVQTQFGKKIKFVRHDGAREF
ATNSLKAFYEVEGIEQQTTIPYAHQTNGTAERAIRTIVTIGRSMLHHAKLDKCFWAEAAM
TAIYVKNRLPSPKVEHKTPFQIVYKSKPSVKHMRVFGCQTYILTPKEKRRKWDPKARAGL
FLGYEEVSKAYRLYDIEAGQVVVSRDVNFDESAFGLSAHTSDEDVDDAALDLDALDLDDN
DGPRQTSFKQAGKRKSRPSGDDDTARRSRPVRHRAGFEEASAPDVSSSRRAEPDEEEKSG
DQDEDDDSTPPVFWRASANAVETAADLSEPTTFQEAVNGPDQVHWRKAIRAELKSMRLRG
VFRAAKLPSGQRAIGTKWVFKIKRKADGSIEKYKARLVAKGFKQKYGIDYTETFSPVAKY
VTLRMIIAIAKYFGWPLDQLDVVTAFLYGVMKEVVFCVVSEGAELDGDFDCLELVKAIYG
LKQASRVWNETFDEFMCSIGFQVSAFDPCLYIKVVDGQCVLVLVYVDDWIHRLLCEILAA
ANETGPELMIREDNQSCIKMTKNPVNHGRAKHIDIKYHHIRDEVKRGEVKLEYCETSVML
ADIMTKALAGPRHTELTAALGIHGISAPVSPRVLPSLRSVKLHGVKIHTFHHYPLSSLLK
KDATWSWRPEHQVAFDSVKKSLASAPILMIPDDVKPFHVVCDARDFAIGCALMQFDNEGC
ERVVSYQSRQMKPAERNYPVHDKELLAMRYALIKFRVYLLGEQTFAVYTDHASLRTAMKS
PHMSQRMARWLSFFAEYNFVVHYKPGKNNILADALSRRPDYDPRATRGRQVIDEDEDDED
HCTMCLTSGVNLMNVTPEMPLREEIAVAYNDDAVYAAILAHLLSPSDKTLRALPNNTRNQ
INRYQLDGDLLTYSIDRFDAPRIAIPNDDDLRARIIHEFHDSPVGGHLGREKTFAAVSRD
FYWPHMYKWVRKWVRTCEICQRVKPSKSSQAPLRPLSIATEAWRSVSMDFIFGLPPDADG
RTGVLV
Download sequence
Identical sequences H3GE80
jgi|Phyra1_1|73942|fgenesh1_pg.C_scaffold_5000149 164328.JGI73942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]