SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI74305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI74305
Domain Number - Region: 236-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0349
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI74305
Sequence length 294
Comment (Phytophthora ramorum)
Sequence
MSGTRYTVDPDGDMEMSIPQPIFEDVKPPELSSWDHAVLIEWHRDGYRQELPEAKDAEKT
SYTCCHMLKNEFVPDVTSLFRQRLKMDLSLDDCDARIFRYYEDFNGIVEDNALQGLIGTG
NESDEEYKGRMKARCRLLVDNIQPPVLKAQINRLIELERHDCKSDDVALFDLILEHAKVQ
QRFHWMSQDHAAKTDSKSSKPERKQQRQGSARATQAQAQASPLAAASAPATAPVPPHDGC
LFCKGAHWLKDCPTATDAQRAEAREKFKAAKEQRAGALRSGLITPYTSEETPDR
Download sequence
Identical sequences H3GF43
164328.JGI74305 jgi|Phyra1_1|74305|fgenesh1_pg.C_scaffold_7000076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]