SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI74347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI74347
Domain Number - Region: 237-278
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0952
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI74347
Sequence length 435
Comment (Phytophthora ramorum)
Sequence
MANNSTSGSFDRLVFPKDTNQFGVWKDLIVGHLRQKSAAMRREAIVKGLAEPAFGFEDLL
RTNCEIPRPMDDGDEEAQRAYRFQQVTLGDQDAYIRALLSQTLPRSYLESLRSSFNDNTL
YVAWQRLDTVYGDSNAQGMAKLLARFDAALAMDFKSVGELILCVKEARNRINRQSRDALN
GVTMIPNQYAAMKVLSLFPSQYWGNHVEYSSGTFHLDRPIEAMQSTAMPANHARASQHLG
KRKARNTDRRNEDCFYCDGKYNKDGLFHMKRDCPKMLEDRSLGLMRANIYVKGTRVAVPS
RTVGVAHARGTKKGAKKKARTVRAEIPVDVALLQPISKPKRVAAAQAKQAEPGPSRSDTL
TPEQAKADEDALMLSPPPTPGSPVVSNTPLSDDDDVDDFATGQLLALAGKVTEASSSIAK
ASANIEKTTQGAATV
Download sequence
Identical sequences H3GF84
jgi|Phyra1_1|74347|fgenesh1_pg.C_scaffold_7000118 164328.JGI74347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]