SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI74699 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI74699
Domain Number 1 Region: 462-622
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.07e-30
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 2 Region: 842-1058
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000147
Family Reverse transcriptase 0.047
Further Details:      
 
Weak hits

Sequence:  164328.JGI74699
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000159
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI74699
Sequence length 1489
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSE
GGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLKMSSPELRSQD
VVKVLTNEHIKRQGEKTASVKTEDAAKAFNTDRESRQCTYCGKLGHTVDKCWTKQKDENR
GPRRGGNGNGNGRGRGANNAQWRNDDASYNYGYGYDRVAFAVSLDGATHHICNDKAAHLI
ERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSVPQINK
SGLFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQTPQRSANAATSGKTVDLHARMGH
APVEVLRKMVDNDMIKDVKAPSKSSGPSKPFPSNCDKRRYDTFELLHFDFCGPMEEESLG
GSKYLLLIVDEASGCMKGFCLRAKSESKDCIKAYVTKVQTQFGKKVKFVRHDGAREFATN
SLKAFYEVEGIEQQTTVPYAHQTNGTAERAIRTFVTIGRSMLHHAKLDTCFWAEAAMTAI
YVKNRLPSPKVEHKTPFEIVYKSKPSVKHMRVFGCQTYILTPKEKRRKWDPKARARLFLG
YEEVSKAYRLYDIEAGQVVVSRDVNFDESVFRLSAHTSDEDVDDAALDLDALDLDDNDEP
RQVNFKQAGKRKGRPSGDDDTARRSRPVRHRAGLEEASAPDVSSSRRAEPDEEEKSGDQD
EDDDSTPPVFWRASANAVEAAADLSEPTTFQEAVNGPDQVHWRKAIRAELKSMRLRGVFR
AAKLPSGQRAIGTKWVFKIKRKADGSIEKYKARLVAKGFKQKYGIDYTETFSPVIKYVTL
RMIIAIAKYFGWSLDQLDVVTAFLYGVMKEVVFCVVPEGVELDGNFDCLKLVKAIYGLKQ
ASRVWNETFDEFMCSIGFQVSAFDPFLYIKVVDGHCVLVLVYVDDVLITGSSPELISRTK
TDLKTRFEMPDSGKCAFVLGIELVDGPDGSVTMCQRRYVDDILKRFAMDECRAVVSPVDM
STRLVPSDAATKVNVPFREAVGALMHLMTATRPDIAYDVGYVSRFMENPQEEHWVAVKRI
FRYLQGTKTHGICFKLGDKIDFQKKEKKKKEDGERSEVSGTSNAGEVKWNAYRGFGAFRF
VVRDADFDEPMDYSDAKEDDEEDDLEEKATMPELSEAAAVSVGRSGGVRSLARNLTEELN
EVAGPEPANGYDEDESDDHRSSAMAENANSRPNGGRPPLNGDTPAANRVLGRYLELMKVK
SNWVRSFAPEVVRQAIWMELGGELTVPVESWNTRQVAEDTVQLLRAMGCEPQVFPSEADL
RAWAPEDAATALRKWKQKLRSAFGVAEAGVSRPPNVRHASDPVDPSMILLPSTPGRRPRG
STEAGIFSAQGATSTTTGERGRGISNRSDCWTKRKSDAQPTLRPPRRLI
Download sequence
Identical sequences H3GG03
jgi|Phyra1_1|74699|fgenesh1_pg.C_scaffold_9000102 164328.JGI74699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]