SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164328.JGI74815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI74815
Domain Number 1 Region: 75-122
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.46e-17
Family Transcriptional factor domain 0.0054
Further Details:      
 
Weak hits

Sequence:  164328.JGI74815
Domain Number - Region: 12-43
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000171
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI74815
Sequence length 125
Comment (Phytophthora ramorum)
Sequence
MSTEFFASSATATGPAFCPHCGTILDHPDTNSIVCSACEYRCRYQDLPSLTVVTKSEDKP
TPKWLNTEKVMSEVTGPARATVEETCPKCGNLEMDYYTLQLRSADEGQTVFYECKKCGHK
FSVNN
Download sequence
Identical sequences H3GG85
164328.JGI74815 jgi|Phyra1_1|74815|fgenesh1_pg.C_scaffold_10000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]