SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI75161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI75161
Domain Number 1 Region: 242-524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5e-62
Family Tandem AAA-ATPase domain 0.00058
Further Details:      
 
Domain Number 2 Region: 569-596
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000733
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI75161
Sequence length 619
Comment (Phytophthora ramorum)
Sequence
MAEEALYVPLKVRRQREQERLQRRRKVLQERTHQDSDSDSDSEQPAKRPKTDEEDASLAV
PDARSSVSLLDQAYEMRKRLEAQGVNQHKAQQDAHEVTMLKEASYVQKAALVSAHERAEG
IHYQETMKTTWRPPRSIADMTSDECDAVRKKWHILVEGQDVPPPIKSFEFMRFPKAILDA
LKAKNILRPTPIQVQAIPCILAGRDMIGIAFTGSGKTVTFTLPLVMLALEEEKKMPIVGH
EGPFGLIVGPSRELMRQTFDVVKHFTNHLFKAGYPELRSLLCIGGEDKRQQSDLISSRGV
HIVVATPGRLNHFLKLREMNLRLCKYICLDEGDRMLDLGFDEEVATTFNHFTSQRQTLLF
SATMPQKFQDFAKDVLVKPVLVNVGRAGAANLDVIQEVEYVKQDAKIVYLLECLQKTSPP
VVIFCERKGDVDDIYEYLILKGIEAASIHGGKDQEERNEAIDFFKNGHKDVLVATDVAAK
GLDFPDIKHVINFDMPAEIENYVHRIGRTGRCGKTGVATTFINKSVPESALLDLKHLLVE
AKQTVPPVLKALEDPYEELERSGDGLSNATGTKGCAFCGGLGHRITDCPKVDSQVRKIGA
GKRDFLAGKNEGYGGDSLG
Download sequence
Identical sequences H3GH04
164328.JGI75161 jgi|Phyra1_1|75161|fgenesh1_pg.C_scaffold_11000173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]