SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI75586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI75586
Domain Number 1 Region: 111-139
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000502
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI75586
Sequence length 164
Comment (Phytophthora ramorum)
Sequence
MAYHYQSLILRCKQGKRTLQDYVMELQNLEAAMAGAPLSEDVKVTVFMDGVRPGPVQPEL
FRIQPKTFNDAVHITIQEDRCVRSVQGYAGRAEATEGPTPMEISSTESARTQRNQRASCR
GFHCNQLGHFRRNCPTNPWKTDRGKAFLSLNMIEFAVFENGDSQ
Download sequence
Identical sequences H3GHX2
jgi|Phyra1_1|75586|fgenesh1_pg.C_scaffold_13000152 164328.JGI75586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]