SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI75729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI75729
Domain Number 1 Region: 474-638
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-29
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 854-1069,1097-1283
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000504
Family Reverse transcriptase 0.048
Further Details:      
 
Weak hits

Sequence:  164328.JGI75729
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00017
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI75729
Sequence length 1332
Comment (Phytophthora ramorum)
Sequence
MPSAHDASTKVSIDKFNGDNYATWNRYIRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSD
GGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQD
VVKVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENR
GPRRGGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDS
GATHHICNDKAKLAHLIERNEGERSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNAL
YLPSMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQMPQRSV
NAATSGKMVDLHVRMGHAPVEVLRKMVDNDMIKDAKAPSKSSGPSPFPSNRDKRRYDTFE
LLQFDICGSMEEESLGGNKYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVQTQFGK
KVKFVRHDGTREFATNSLKAFYEVEGIEQQTTVPYAHQTNGTAERAIRTIVTIGRSMLHY
AKLDKCFWVEATMTAIYVKNRLPSPKVEHKTPFEIVYKSKPSVKHMRVFGCQTYILTPKE
KRCKWDPKARAGQFLGYEQVSKAYRLYDIEAGQVVVSRDVNFDESAFGLSTHTSDEDVDD
AALDLDDNDGPRQMSFKQAGKRKYRPSGDDDTARRSRPVRHRAGLEEASTPDVSSSRRAD
PDEEEKSGDQDEDDDSTPPVFWRASANAVEAAADLSEPTTFQEAVNGPDQVHWRKAIRAE
LKSMPLRGVFRAAKLSSGQRAIGTKWVFKIKRKADGSIEKYKARLVAKGFKQKYGIDYTE
TFSPVVKYVTLRMIIAIAKYFGWPLDQLDVVTAFLYGVMKEVVFCVVPEGVELDGDFDCL
ELVKAIYGLKQALRVWNETFDQFMCSIGFQVSAFDPCLYIKVVEGHCVLVLVYVDDVLIT
GSSPELISRTKTDLKTRFEMTDSGKCAFVLGIELVDGPDGSVTMCQRRYVDDILKRFAID
KCKAVVSPVDMSTRLVPSDAATKVNAPFREAVGALMHLMTATRPDIAYAVGYVSRFMENP
QEEPWVATKRIFHYLQGIKTHGICFKPGDKIDFRGYSYADWAGDLADRKSTSGYTFMLMS
APVSWGSKKQSSVSLSTCEAEYIALSLAIQEGKWIHRLLCEILAAASETGPELMIREDNQ
SCIKMTKNPVNHGRAKYIDIKYHHIRDEVKRGEVKLEYCETSVLLADIMTKALGGPRHTD
LTAALGIHGTSH
Download sequence
Identical sequences H3GI75
jgi|Phyra1_1|75729|fgenesh1_pg.C_scaffold_14000091 164328.JGI75729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]