SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI75730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI75730
Domain Number 1 Region: 257-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000051
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI75730
Sequence length 357
Comment (Phytophthora ramorum)
Sequence
MRIQELKLKLSGAARDWFNQLPKHTQRDWKELATAFRKKYCKARASYSERYYTMEMRSSE
SALDFFYRLNSAAGKADIDFRKSTKRLEKHIRRFITKLKETRLKTSLQGQRFKSISDLEY
ALEQDEEVWTQNERDAATSRNRDFRAGNLSNPGRPRPKRFERAYLTQNADFGVKMSEYPE
ELPRMQDAVEESGVSVQGVDPGSQDTRDDGGALNAGPSGAEWTQTLTNEVYRVMDNMGWR
PPGHASHGNPVPNSGRRENPNWDKYCEKCRKWGHPEESCWKDIKCDRCQELGHPTHMCRA
QPCDNCGKLHQGKPCEDWKALEDLKKLARQGALKDLPSHILDKLLDGEASTGKPLNL
Download sequence
Identical sequences H3GI76
jgi|Phyra1_1|75730|fgenesh1_pg.C_scaffold_14000092 164328.JGI75730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]