SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI75738 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI75738
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000137
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Domain Number 2 Region: 104-148
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000366
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Domain Number 3 Region: 4-57
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000115
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI75738
Sequence length 150
Comment (Phytophthora ramorum)
Sequence
METTADQRKCHNCGQAGHIRRDCPEAPSQEGGFSGGFNSGAACFGCGKTGHLKRDCPTGG
RACHNCGQVGHIRRDCPEDVQPPKCHNCGESGHLRRDCPQELRESRKCHHCGQSGHLRRD
CPDDSGPSEDKCYQCGETGHWARNCPGAKE
Download sequence
Identical sequences H3GI81
164328.JGI75738 jgi|Phyra1_1|75738|fgenesh1_pg.C_scaffold_14000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]