SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI77006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI77006
Domain Number 1 Region: 355-408
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000057
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Domain Number 2 Region: 215-254
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000014
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 
Domain Number 3 Region: 255-295
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000105
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI77006
Sequence length 489
Comment (Phytophthora ramorum)
Sequence
MRGENAGVLDAMSDVSESSDSDEELLHVMDPSDPRAHRLEPLAVQPTRRQQQNQKLSRWD
SDSDVGEPITVDSETENQTPKPAVIKIDDAIVAPSKKLTLSKWAQARFLVPASQRKLPVL
EEPPLEPLNDFILSDFSSRFRGETGDVPVEKQIAAEDEQQDEDGKLQVGAPLFDANKEKE
NADKDDDKKNRKKKKDPSEMRKRKENRYFVTDLATKCFHCGEVGHMANVCMNDKLQRPCY
YCALRGHQAWECPNLPCANCLQLGHQERGCDNRSKHLDPCSICGRGGHVDDDCENVESQD
LLTCMVCTTAGHLHCVPVPPPADRRVYCPHCAENHTLDECHTYREPAATDFAIRTSSGRT
VQTCFVCNEPGHIAAECPIRTNGYSRGGGGNCFKCGKPGHFAADCYSSNDNGNGRRVTGR
KRGRDVEDEYPDYNGYDYDENEDYYSYDRSSKGGKKSRNRGGGSSRTRNSSGSQGNNNSY
GDRRRSTRR
Download sequence
Identical sequences H3GL03
164328.JGI77006 jgi|Phyra1_1|77006|fgenesh1_pg.C_scaffold_21000147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]