SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI77063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI77063
Domain Number 1 Region: 464-844
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-102
Family Reverse transcriptase 0.00016
Further Details:      
 
Domain Number 2 Region: 1083-1238
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.18e-34
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 
Domain Number 3 Region: 1388-1455
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000751
Family Chromo domain 0.0055
Further Details:      
 
Domain Number 4 Region: 232-327
Classification Level Classification E-value
Superfamily Acid proteases 0.0000413
Family Retroviral protease (retropepsin) 0.028
Further Details:      
 
Weak hits

Sequence:  164328.JGI77063
Domain Number - Region: 135-158
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000212
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI77063
Sequence length 1574
Comment (Phytophthora ramorum)
Sequence
MPKFLGTKEDDVGDYMFSAKLYFESKNIKYGGTSRVSKTTSPLSEASSAMSDIDKVMHFQ
KGLLTDIKQEVKLRQFSTTTEAISFALMYDHTHFVSSRHQSSQRRSSPQLRQRIEEQPTS
MEIGNARIISREECMRRNLCLYCKEPGHRLADCRKRQARNSSRDPSRPPHGRSSFRANQN
SFRHVVEAEDGPDGEEDFVDDNDNLVEVTDSLQLNMVSVDSGAPSKRELRRFEGMVNDQV
VRVLIDSGAERNIVRPGLAQHFVDAAKVTAEHFDGTTTPARTAHRCCETLSFDGRDFADV
SLFEWEVSSNQDVILGHPWLVQFNPIISWQTGVMRIPRPRLVLDARSINDSLDVAPPALA
AVEVTSKFLQHPLPSNLRQQLDDHVKAGYFICHWVQAPLRHLVVGRRLTARARTENEAAT
SLCVISAAQFATKVKAETYVELYHVTVKEPPNVKTVPPQLQAVVEEFADVFPAELPPGLP
PQRSIEHEVIVKPGAKPSNRAPFRLSKAEQEALDIFVAELLKKNWIEVSDSPWMSNIFGV
PKKDPTIGKFPSRLEWLHSNNPHMAIRWVIDYRLVNAASEVAKIPLPHIEQLFDRMVGAV
AFTILDLASGYHQMRMAPTSKQYTAFRTNQEIYHWNVAPMGLAGMPATWTRLMHNVLSHL
AFVVVYLDDICIFSRSMADHVEHLQRVCEVLRQHQLVISASALLIFLATRSRSTVYTWTR
AIAEWMEPSNIKDLQRFLGLVGYYHRFIHRFATLVLPLSALVKMDVPWAWDDTLRLSFNA
IKLTLQHPPVLRLPDFDRPFIVTTDAGHACTGGVLSQLHDGSDIPVAFFSKKLGPHELNW
PFTLHHRPGAMNVIADALSRPPGPSSSLGEGQDDNESKPVTVSLCAACRSSPTCTDIRQA
ASRRTKTTEKIRSIPTRDQDVILAVKKPVAELHDVGTAQLRMRVHAFSTAGSTVISSLQL
DTQTKKAFQKAYDRDPEFKHLWKYGRTSEEYEVVHGLVYLKSNDNLRRLCVPNNRKLRVD
VIHNAHDAAIMAHPGIRRTQLAAAQWYFWPSMDLDIKSDVQSCESCMRYKSSMGRKTGKL
QPIPLPAACWEVVSTDFITHLPVSDGFDAIMVVVDKLSKRPVYIPTHTTATAEDTAKLFF
NNVIRYYGIPSTIISDRDPKFTSRFWTALVNLMMIKAAMTSAHRAQADGQTERQNRTLED
SLRCSISYHGNDWNEHLPMIEYAHATLVSSSSKLSPFFVDTGRKPTYLLDTGADAASVPH
SRVEHASRFVQHRQEVIERARKNLLDAHATQKKFYDKRRAENPFKVGDLALLSTQDLKIS
HATAETTLRSRKFIPRFIGPYAILEIRGNVALLDLPANLKSLSPRFNIDKLKVYTSNPDR
FDGRMISKSTPVIFDDDGEPLHVVEALIKRRTFNRQPEYLVKWYGLPHHENTWERERDIK
HVSRWQALLKDLCRRSQARACGILFMRGFPVMFLTTRDYGTTNFNFDDFILKVLGLDQLG
GGGECNDLQVQKQSDTPSPGESAQRAEIDICILTKVAQARATANHSQPLHVQERAPSVLV
AQQMRWISLETFTS
Download sequence
Identical sequences H3GL48
164328.JGI77063 jgi|Phyra1_1|77063|fgenesh1_pg.C_scaffold_22000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]