SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI77067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI77067
Domain Number 1 Region: 815-974
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.86e-30
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 457-691
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.67e-29
Family Reverse transcriptase 0.0088
Further Details:      
 
Weak hits

Sequence:  164328.JGI77067
Domain Number - Region: 273-298
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.016
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI77067
Sequence length 1021
Comment (Phytophthora ramorum)
Sequence
MPGFGVDSDGDVVMTTPQPIFEFIRAPRLTAWSQAALIQFKRERAQYEKKIEERCTVTNE
NKANLLVSIKMSVETRVLDHLARFILRKTLEAVTDADIVAEIERKCGTILNAHVPDVMGM
FKEWLNMDLQEQDIEARISKYFVDFGRLVEEKGFIGVLGSNTGGQVLDRQKMKLRCRILV
ENLAPTVLQVDVKRLVEMTHRDARTDDVRLYQLIVERATMQHHFHVMQKETKEPRTASKT
RVTSTTTAAKTTATKAEGVGAVKPKSNVKASVGGKVQCWVCKGGHKMRDCPTATDAEKDA
ALAAWREQRKSQPERAKHVAEGSSKKVVLVNSILEIPLCPDTGSDRNIISRDYLNEQREL
GAEVTTAPLAEVPVVVLEGPKDKFLLGRVTLKEIGIDIDYLLEQLASGGREGEIGAADED
DLPPEEELRFEAEDGDVAAAMGYLVDDAVANGFAAEHVVPGATPFRCKLRKYPERQRAFL
RKYVQQLVDAGLVMRNNDSRWACAALPVKKSSVPLAAATPNLAVVTQSVKGASDSALHFQ
AQMQECFRSLLYNAALVWINDILLFARSPGEVLEKLRAFFIILRQRNLKLNAVKCKLFSK
KVVWCGKVIDESMVDYARTVAPLQHKLEEVMVARGRHLTWTKDDESAFRVVLKLLSNSSK
MFFPDRDAHVCLFSDASASGWAVVLTQVREWPTDTPVEEQHHEMLPTAAEVKVVLGRCKK
DMPPAASIVEGLATIDGKIWIPSTSHSLLVRLFIVAHCGVQGHRGEHVMAEQLSARFSTK
NLAAKVAKFVRECLLCKHVKGGKIIQRAWTTDREVSMRNERLHMDYLFLGDRYGSTKYVL
VLKDELTHFCELVPADSAGSEVVVASILDWFKRFGLPESWESDNGSYFKAEVMARLCERL
KANQSFVPVYTPWINGTVERINRDILQVLRAMILEFQLDTRNWLYLLPLIQANLNHSPVA
SLGNHAPIEVFTGLPAPSALDTIAVPSDKGTRLVPVDPKRVSAHMEKLRNSLHAMHKEAT
T
Download sequence
Identical sequences H3GL52
164328.JGI77067 jgi|Phyra1_1|77067|fgenesh1_pg.C_scaffold_22000038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]