SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI77355 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI77355
Domain Number - Region: 139-159
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.034
Family Retrovirus zinc finger-like domains 0.0085
Further Details:      
 
Domain Number - Region: 61-119
Classification Level Classification E-value
Superfamily UBC-like 0.0379
Family RWD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI77355
Sequence length 159
Comment (Phytophthora ramorum)
Sequence
MDAGYDHVVDDCEEAGVAWTRLKTLYDGSQKAGHIYLKRQLFSMEMSEGGNVLHHCSGVL
NISAKISSIGAKMEDEDVAICLLRSLPKSYKNVVLDLEMSSAELRSQDDVKVITNELIKR
QGEKTASVKMEDATKAFNTDGESRQYTYCGKLGHTVDKC
Download sequence
Identical sequences H3GLQ9
164328.JGI77355 jgi|Phyra1_1|77355|fgenesh1_pg.C_scaffold_24000024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]