SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI77456 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI77456
Domain Number 1 Region: 639-1046
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.49e-79
Family Reverse transcriptase 0.0001
Further Details:      
 
Weak hits

Sequence:  164328.JGI77456
Domain Number - Region: 429-463
Classification Level Classification E-value
Superfamily Acid proteases 0.000901
Family Retroviral protease (retropepsin) 0.0098
Further Details:      
 
Domain Number - Region: 360-390
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00209
Family Retrovirus zinc finger-like domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI77456
Sequence length 1067
Comment (Phytophthora ramorum)
Sequence
MSDKEDSSVEELAARATATELSSAGSPSPPPPSRPRRSPELQLQLPNPFEARQEDESMPT
ASPERNAGGLSHGEEEQERSVPQPVAAAPALPQPPRFAGRTMQDRRVFMREYETYMIAIN
ALQTQWNGAFAMPVGACIESRTKRMIARYEFNLPPNMISEQQWIDYFKQALSPSHIDYAT
VDKAMKKLRMETRWPEPESRMMNLQADMEAILDEFNLTDVAFAHEQRRLVKYLADALAPP
SFKAVIATKLTLRENKNFENEVVPFCSWVTKLMKEFMTWEHAAQAAAGHVSSSQQQGGRR
GNNGGRGGEGARGANGGRGVSTGVSNSGRNNGAGSPPTRSGRGGGSAQGTASASVVRAST
GADTRTERGACLKCQATDHQVRECPRCKPGEAPQLLRAMREQRNASRPASMRKFDVTLSG
AELDDDQGTVAAAVDGVPVKALLLDTGADTSLVTQSVLEALGQAGRSVQVNRVDGVKLSP
VGGRAVDVSRVATFKEVVLTTSAGPLMLRSLACYVKEESLSLDLTVGRPIMKILGYSTDK
LLVGARSNKPEWELGGSTREEKAEPSQLQKMCRLQVEAREGTAANDAEDDGDRHETRTAL
PTMRPTNMAEVILYLEAKARVAEELGLTLDGTAKLRGILHARADNFRVEFGHAPPVRVAP
MKVRLREGAAPVRSQLRRYSPNDRAFLDRHTASLLKYGLIYKNHRSRWASAPRIVRKKGQ
NVDPTADPRMTIDTRSVNERTEPMPWPMPVQEVVLGELEGAKVFFVLDWFRGYWQLPLHP
DSQELYSFVTHRGIYTPTRVPMGATDAVAYCQGIVEEIFGDLLGVSVLAWLDDILGFAED
DDALLDVLDTVLERCEKFGLKLHAKKCQFFSREIKWSGRMISGDGVDMQLPTTAGELQQF
LCAVNWMRQSIPEFTRITAKLYDALERAAQHAGPRKKLKLSRVRLEEIGWGEAEISSLEA
IRGCLLRMVPLAHPKATAELALYTDASQVHWGAILTQLEPGELALLLAEQKHQPLAFLSG
RFAGAASRWPTIEKEAFAIVEATRRTDGFSSGSGSPASNTSIGFDGS
Download sequence
Identical sequences H3GLY9
164328.JGI77456 jgi|Phyra1_1|77456|fgenesh1_pg.C_scaffold_24000125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]