SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI78075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI78075
Domain Number 1 Region: 194-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000331
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  164328.JGI78075
Domain Number - Region: 383-486
Classification Level Classification E-value
Superfamily Acid proteases 0.00128
Family Retroviral protease (retropepsin) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI78075
Sequence length 556
Comment (Phytophthora ramorum)
Sequence
MQPGKTFADFESGLRDAAGQNQRQAEYWTTVGYRNDAYSSAEDGTAGAMRVIPGIGSMSA
DIAGAPTADNTEIVEEYAYFTNPQGVSHRNSNVWVAPAGMAWNGKFWKLNKKDRQRESKT
AAFDQKSMGKRRAEKQERRMKVMMVAASDASSDDEYEPTLPPTKGKKQNASVWQVNASER
TKDALSTRAAALPGKQPSEPYRCFACGADGHFARECPDEAAKARNDAYLAGRKAKTDPAE
NAGRAHNQMKRPDGTSMNEGGEQAPAETPVALMQKFLATDSRATRATSNDRMQSETVSVG
KQLRKNEKKKRVQRAMQKAEASQINGEDVDQIGESDDGGTHETPDSTWKLDADSEEMLHD
HGEASERRQDGDDDELGKAAASDGLPTAEMVVDGERVQVKLNSGARYSVAGTDWMQRGER
VRQAAPVECVEGIGGFLLDVLGVWTFCIRKAYGQLVQVKACIIEGCTDEFRIGVGFMRRH
RAMLDFERNEVRYFDHNVQVVIPFRTSVGDGDTKVAAVRLVTYTRLMRSSVTPIEMSVAT
PDRKKAYSYPWGNALQ
Download sequence
Identical sequences H3GNB0
164328.JGI78075 jgi|Phyra1_1|78075|fgenesh1_pg.C_scaffold_29000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]