SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI78222 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI78222
Domain Number 1 Region: 293-331
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000401
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 
Weak hits

Sequence:  164328.JGI78222
Domain Number - Region: 378-473
Classification Level Classification E-value
Superfamily Acid proteases 0.000563
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI78222
Sequence length 647
Comment (Phytophthora ramorum)
Sequence
MNDTSMSDASTLSGATGVSLEHASFPHLSLFEWEALHRLAAVSGDGVIRTLLTAGTEEQQ
RLAAQEFMARELTDLRRRATTPTPSTNKTDIVKLDVSTYSGEGKTRLHLNRWFCEVDIAI
EARQLSTELARTRFLLSKLSGKAKEWALGRLVANASCFPTMAAMQADLRLAFEPPQDESV
QRSAFLSLKQGGLSMLEYIQRTRHLASCITTQPVDMTTQVHVFVSGMNAGYQRFYLTRKT
PSTLEEAFTIALREDYSVSASQAFDVSRPLVHDPEPEPMEVDAIQSYRGRREPTSPSRQS
STRGSRPMKCFRCGKPGHRAAVCRAPSPMVANATTVNDVAAPKNGDDHPPVLHARLSATT
SGSDSRLIVLSLHVEGAQRPIRALLDSGATNNFVRAASLSALPADMSVRESGGEMIVKYA
DGKPRRTPWRSATFAYEFDGFRSSEEFLVIELSGSFDCVFGIPWLARHQPAIDWLAGTVR
PRDIDVNAVEAFLCGTPTQWPHVTVMDPDSMAHAAPEESDGPSCVVCEYATCAGPEQESQ
DASDVVEHGFPRPDEQRFSEEDDVVEHGFPRPDEQWLSPREDDDVVERGLPLAVEHGFPR
VDERELPEEVDAAEQLAPRLGADDEFRHSEPREQGFNEGRSHGEDAC
Download sequence
Identical sequences H3GNM8
164328.JGI78222 jgi|Phyra1_1|78222|fgenesh1_pg.C_scaffold_30000027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]