SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI79080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI79080
Domain Number 1 Region: 447-668,708-892
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-33
Family Reverse transcriptase 0.021
Further Details:      
 
Domain Number 2 Region: 178-208
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000275
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI79080
Sequence length 944
Comment (Phytophthora ramorum)
Sequence
MCALVHVALSTTTADQATFKRKSRKALAIICLAMEDSQLPLVRSAKDAHDAWSRLEGHFE
KKSLANKLFLRRRFFTTMMDEGDDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLS
ESYQFLITALESRADSLSWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMTRDNKRK
GRPVKKTGACHNCGKQGHWIAECPSRVQNDAERYRSQLPPRPSDMWLVDSGATQHMTSSK
TYMRNYKKMAPVDVHLADDGVVQAGSGXKFDARSVRCRFLGYSEHEKAYRFEELESSRVL
VSRDAQFMEDVFDSGRRDYHQREVVVIQDEETTDQDSSQSDEDDNEEEEEEEAARDEDFG
PGNKRHPRTQSLEEVTEVPSAKRYASQSRHQTLDEMSAAAQESQDFEAAYVVDSVGEMPT
TFKSAMESSDAVKWKEACDSECDSLLKNDTWDVVPLPKGRKAIGCRWVFRVKENQAGEIE
RFKARLVAKGFSQKYGIDYDEIFAPVAKFTSIRIVLSLAAKYSLKLHQMDVKTAFLNGVL
DEDIYMAQPDGYVDEDHPDHVCKLKRSLYGLKQSPRMWNQTIDDFMLKLGFKKCESDHCV
YLKRDGQDIIFVALYVDDLVLASSSDKMLLDTKQALSHRFEMMDMGQLKYFLGMEIEQDV
VTGKMSMRQTKFAKDILQKFSMDKSNPVKTPQDPGLKLTKAMCEGGCKHDETMVNVPYRN
AVGCLMYLMVGTRPDLAAAVGVLSQFAADPCPTHWQALKRVFRYIQGTKTHGIEFQASCH
DGLQGYSDADWAGDIESRRSTSGYAFMMNGGCISWRSKKQRTVALSSTEAEYMALSEATQ
EAVWLKVFLCELGEMASEEAVKIYEDNQGSIALTKNPQFHKRTKHIDIRYHFVREKVEDD
IMTKAITAVQFQVLRTKLGIQGAIAVESSGSVVKKAPRAAAVYR
Download sequence
Identical sequences H3GQK5
jgi|Phyra1_1|79080|fgenesh1_pg.C_scaffold_37000001 164328.JGI79080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]