SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI79146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI79146
Domain Number 1 Region: 638-856
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-18
Family Reverse transcriptase 0.015
Further Details:      
 
Weak hits

Sequence:  164328.JGI79146
Domain Number - Region: 329-359
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00123
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI79146
Sequence length 1141
Comment (Phytophthora ramorum)
Sequence
MEHEEDNQGGRSAEAEEDPDVDQLAGRAAAMQLESAASLTPRSPGLRLQIPNPFEQMSAE
ETDEAMATASPYAGGQSVAAAPAFLQPPRFQGRTMQDRRIFKRQYDTYLGTINALQTQWG
GAFAMPVGACIESRTKRMVARQANTPSHIDYTSVDEAMKKIQMKTPWFEPESRMMNLQAD
LEAILDKFNLTDVAFKHEQRRIVKYLANALAPTCFKAVIVTKLTHENKTYKDEVVPFCSR
VTKLMRSSKCMEQNHQQQRSSNRGNTGGRGASGGHGQGGRRGKGGGSGGGDRSGANDNRG
GYGGRAGGDVARALQARGSTGARAAGASDEDTSERPSHGACMKCRSMDHQVRDCPSCQPS
EATRLLQALRERREATLDISVRRFAVVEPEESPMQQEDADDDRGAVAADVDGQAVTALLL
DSGADTSLVACGVLDELRNSGKDVPVRMVDGVRLNPMGGHEIQVQRQVTFKEVVLTTSAG
PLMPRNLACYVEEDNASLELTVGRPVMNILGYWTDKLLAKAKDARSEWEVGDLQQECSGE
EVPPTALQRVCRLQVLDRDPLLTAEASDDVERYETRTSLPTIRPTTPDEVVLYLEKKVEV
TTEMDLTLDGRVKLHAILHYRVDCFQLEFGNDLPVKVAPMQVRLKPDAQPVRDQPRCYSP
NDPSLLEHGLVFKNHRSRWASAPRIVRKREQDTDPTADPRITIDTRDDILGYAESEEALL
EVLDKVLERCAAYGLKLHAKKCQFFATERVGSHKQTQLAKVRLEDIGWGDQEIAGVEDAR
TALLGMVPLAYPSPTADVCLYTDAGQDFWGAVVTQLEPHEVSLPLDKQNHRPLTFLSGRF
VGAVVRWSTIEKEARWGAGQDQPADRAGVRGARLAVVERVSPLVEPDFVWPTEAQIKELQ
QHAQDAGADLQGAQWSDERQLMVTPAGQVWIPADSHEIQQRLYVIAHAGASGPRRKGDGQ
GTVELFVWPTLTKDVALFVNGCLHSMMTAEDRMPRPFGETLKAIKPNKLLHFDYLTMIEG
NNGMSGRRCAAPLHDVLHAVGQRHRNREILNCVRALLSERKPHVRDWPAVLPVVQAALNG
MPADRLNGVTPLTEFRALPGGAPDKTRSDAVLHARGTRGAKGCGFPSSAKKPSCWPRPYK
S
Download sequence
Identical sequences H3GQQ9
jgi|Phyra1_1|79146|fgenesh1_pg.C_scaffold_37000067 164328.JGI79146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]